Development of a novel approach to influence the secretion of pathogenicity factors of Staphylococcus aureus by synthetic peptides
The emergence of antibiotic-resistant strains of Staphylococcus aureus including MRSA and VISA demands a modification in the attack strategy of antimicrobial agents. This prompted the search for novel compounds and new bacterial targets to combat infectious diseases that are associated with this pathogen. In this study, the major bacterial secretion pathway Sec was chosen as a novel target, because it has been identified as being responsible for secreting most of the staphylococcal proteins, which act directly and indirectly in the phases of infection processes. Depending on their signal sequences, the Sec-dependent proteins are directed in unfolded form through the bacterial membrane and displayed on the cell surface or secreted into the environment. We developed an approach, which should allow inhibition of secretion of a Sec-dependent protein (V8 protease). The approach utilizes chemically constructed peptides that represent the 29 amino acid secretion signal peptide of V8 protease (MKGKFLKVSSLFVATLTTATLVSSPAANA) conjugated to a cell penetrating peptide that facilitates the entry of the construct into bacterial cells. The signal recognition particle (SRP), the ATPase motor protein (SecA), and/or the signal peptidase (SpsB) were hypothesized as possible targets in the Sec system. Those are known to interact with the signal peptide of the secreted proteins, and thus may be competitively inhibited by the constructed peptides. To test this hypothesis, it was necessary to chemically generate the potentially Sec-interfering peptides, and establish appropriate assays that facilitate monitoring their effect on inhibiting this type of secretion. For that purpose, the fluorescein-conjugated forms of three known cell-penetrating peptides (CPPs) were first synthesized. The uptake efficiency to these peptides by S. aureus was investigated using fluorescence microscopy and FACS analysis. The HIV-Tat derived peptide YGRKKRRQRRRC-F5M showed the most promising properties. Based on this result, eight further peptidic constructs were chemically synthesized. A subset of these peptides contain the three different N-terminal forms of the secretion signal peptide of V8 protease as they may be found in prokaryotes during or after translation: with formylated methionine, with methionine, and without methionine, conjugated to the cell penetrating peptide (CPP). For control purposes, another subset of three forms of the V8 protease secretion signal peptide was synthesized without CPP. One construct was synthesized with a scrambled sequence of the secretion signal conjugated to the CPP, and one peptide was synthesized as unconjugated CPP. These peptide constructs were investigated with respect to their ability to reduce the secretion of the Sec-dependent protein V8 protease. The secretion of V8 protease was evaluated by Western blot analysis, which provided a valid and reproducible quantitative detection. The investigated peptides did not show any effect on bacterial growth and viability. Only one peptide (KGKFLKVSSLFVATLTTATLVSSPAANAYGRKKRRQRRR-NH2) among the different constructs showed a concentration-dependent effect in reducing the secretion of V8 protease, which was inhibited by up to 40% at 40 µM. This effect was not limited to V8 protease secretion. Inhibition of secreted hemolysins and other proteases was also observed. Subcellular fractionation reveiled that treatment of the staphylococcal cells with this peptide showed retention of V8 protease in the cell wall and periplasm fraction, which suggests an interference with the transport of the protease through the cell wall after its release from the membrane. Although the underlying mode of action of this peptide in inhibiting the secretion is still not understood, a fluorescence-dependent analysis of the subcellular fractions showed a localization of the fluorescein-conjugated peptides in supernatant, cell wall and periplasm fraction, cytosol, and the membrane, with the highest abundance in the cytosol. In conclusion, this study can be regarded as a preliminary positive insight that secretion of bacterial virulence factors can be inhibited by synthetic peptides. Although it requires further study, it supports the idea that such an approach may eventually provide a new strategy for antimicrobial intervention.
Die Entstehung von Antibiotika-resistenten Stämmen von Staphylococcus aureus wie MRSA und VISA erfordert eine Änderung in der Angriffstrategie der antimikrobiellen Mittel. Dies veranlasste die Suche nach neuartigen Substanzen und neuen bakteriellen Targets um Infektionskrankheiten, die mit diesem Erreger verbunden sind, weiterhin wirksam bekämpfen zu können. In dieser Studie wurde der bakterielle Sekretionsweg Sec als neuartiges Ziel gewählt, da er für die Sekretion der meisten Staphylokokken-Proteine verantwortlich ist, die direkt und indirekt am Infektionsprozess beteiligt sind. In Abhängigkeit ihrer Signalpeptide werden die Sec-abhängigen Proteine in ungefalteter Form durch die bakterielle Membran transportiert und an der Zelloberfläche verankert oder in die Umgebung sezerniert. Wir entwickelten einen Ansatz, der die Hemmung der Sekretion eines Sec-abhängigen Proteins (V8-Protease) ermöglichen sollte. Dieser Ansatz nutzt durch chemische Synthese erzeugte Peptide, welche das aus 29 Aminosäuren bestehende Sekretions-Signalpeptid der V8-Protease (MKGKFLKVSSLFVATLTTATLVSSPA-ANA) enthalten und durch Konjugation mit einem Zell-penetrierenden Peptid (CPP) den Eintritt in die Bakterienzellen ermöglichen. Wir stellten die Hypothese auf, dass das Signalerkennungspartikel (Signal Recognition Particle, SRP), das ATPase Motorprotein (SecA) und/oder die Signalpeptidase (SpsB) mögliche Targets innerhalb des Sec-Systems sein könnten. Es ist bekannt, dass diese mit dem Signalpeptid der sekretierten Proteine wechselwirken und folglich durch die Peptidkonstrukte kompetitiv gehemmt werden könnten. Um diese Hypothese zu überprüfen war es notwendig, potenziell Sec-interferierende Peptide chemisch herzustellen und geeignete Assays zu entwickeln, mit denen die Inhibition der Sekretion untersucht werden kann. Dazu wurden zunächst die Fluoreszenz-konjugierten Formen von drei bekannten zellpenetrierenden Peptiden (CPP) chemisch synthetisiert. Die Aufnahme-Effizienz dieser Peptide durch S. aureus wurde mit Hilfe der Fluoreszenzmikroskopie und FACS-Analyse ausgewertet. Das HIV-Tat Peptid YGRKKRRQRRRC(F5M)-NH2 zeigte die vielversprechendsten Eigenschaften. Auf diesem Ergebnis basierend wurden acht weitere peptidische Konstrukte chemisch synthetisiert. Drei Peptide davon enthielten die unterschiedlichen N-terminalen Formen des Sekretions-Signalpeptids der V8 Protease, wie sie in Eukaryoten während oder nach dem Translationsprozess vorkommen: mit formyliertem Methionin, mit Methionin und ohne Methioninin, jeweils konjugiert mit dem zellpenetrierenden Peptid (CPP). Für Kontrolluntersuchungen wurden drei weitere Formen des V8 Protease Sekretions-Signalpeptids ohne CPP, ein weiteres Peptid mit einer gemischten Aminosäuresequenz des Sekretions-Signal eptids in Konjugation mit CPP und ein weiteres Peptid als unkonjugiertes CPP synthetisiert. Die Peptide wurden bezüglich ihrer Fähigkeit, die Sekretion der Sec-abhängigen V8-Protease zu reduzieren, untersucht. Die Sekretion der V8-Protease wurde mittels Western Blot Analysen untersucht, was sich als valider und reproduzierbarer quantitativer Ansatz erwies. Die untersuchten Peptide zeigten keine Wirkung auf das Wachstum und die Lebensfähigkeit der Bakterien. Nur eines der acht Peptidkonstrukte (KGKFLKVSSLFVATLTTATLVSSPAANA-YGRKKRRQRRR-NH2) zeigte eine konzentrationsabhängige Wirkung auf die Sekretion der V8-Protease mit einer Inhibition von bis zu 40% bei einer Konzentration von 40 µM. Dieser Effekt war nicht auf die V8-Protease beschränkt, sondern wurde auch bei den sezernierten Hämolysinen und anderen Proteasen beobachtet. In subzellulären Fraktionierungen von S. aureus zeigte sich eine durch das Peptidkonstrukt bewirkte Anreicherung der V8-Protease in der Zellwand und periplasmatischen Fraktion, was auf eine mögliche Interferenz des Transports der Protease durch die Zellwand nach der Ablösung des Proteins von der Zellmembran hinweist. Obwohl der zugrundeliegende Wirkmechanismus dieses Peptids bei der Hemmung der Sekretion noch nicht verstanden ist, zeigte eine Fluoreszenz-abhängige Analyse der subzellulären Fraktionen eine Lokalisierung der Fluorescein-konjugierten Peptidkonstrukte im Wachstumsmedium, in der Zellwand-Periplasma Fraktion, im Zytosol und in der Membran, wobei sich die größte Menge im Zytosol befand. Zusammenfassend kann diese Studie als positiver Ansatz für die Inhibition der Sekretion bakterieller Virulenzfaktoren durch synthetische Peptide gewertet werden. Auch wenn vertiefende Studien notwendig sind, wird die Idee bekräftigt, dass solch ein Ansatz möglicherweise eine neue Strategie für eine antimikrobielle Intervention darstellt.
Preview
Cite
Access Statistic
Rights
Use and reproduction:
All rights reserved